Adamantaneacetyl-Bradykinin [DArg0, Hyp3, Thi5, 8, DPhe7]
- SKU:
- ECH-191-84
- Size:
- 1 mg, 5 mg
- Suppl:
- Echelon Biosciences
Proteins and Peptides
Peptides
We have a wide selection of products in this field of study, if you do not see something that suits your requirements then please contact us on info@2BScientific.com
Academic pricing available. Please contact us to discuss.
14,190 results
Adducin beta 2 Blocking Peptide
- SKU:
- 33R-9887-100UG
- Size:
- 100 ug
- Suppl:
- Fitzgerald
- Appli:
- Immunohistochemistry, Western Blot
Adipokentic Hormone from Schistocera Gregaria [pGlu-Leu-Asn-Phe-Ser-Thr-Gly-Trp-NH2; MW: 934]
- SKU:
- AD-SP-52218-1
- Suppl:
- Alpha Diagnostic
Adipokinetic Hormone (Apis mellifera ligustica, Bombyx mori, Heliothis zea, Manduca sexta)
- SKU:
- AD-SP-100043-1
- Suppl:
- Alpha Diagnostic
Adipokinetic Hormone [pGlu-Leu-Thr-Phe-Thr-Ser-Trp-Gly-NH2; MW: 921]
- SKU:
- AD-SP-55334-1
- Suppl:
- Alpha Diagnostic
Adipokinetic Hormone, AKH, locust [pGlu-Leu-Asn-Phe-Thr-Pro-Asn-Trp-Gly-Thr-NH2; MW: 1159.3]
- SKU:
- AD-SP-55372-1
- Suppl:
- Alpha Diagnostic
Adipokinetic Hormone, G (AKH-G) (AA: Pyr-Val-Asn-Phe-Ser-Thr-Gly-Trp-NH2) (MW: 9202)
- SKU:
- AD-SP-86555-5
- Suppl:
- Alpha Diagnostic
Adipokintetic, Hormone from Locusta Migratoria [pGlu-Leu-Asn-Phe-Ser-Ala-Gly-Trp; MW: 934]
- SKU:
- AD-SP-86563-1
- Suppl:
- Alpha Diagnostic
Adiponectin Receptor 1
- SKU:
- NM-X2050B
- Size:
- 50 ug
- Suppl:
- Exalpha / Nordic Mubio
- Appli:
- Block/Inhibit/Neutralise, Western Blot
Adiponectin Receptor 2
- SKU:
- NM-X2051B
- Size:
- 50 ug
- Suppl:
- Exalpha / Nordic Mubio
- Appli:
- Block/Inhibit/Neutralise, Western Blot
Adipophilin (AA: Ser-Val-Ala-Ser-Thr-Ile-Thr-Gly-Val) (MW: 833.94)
- SKU:
- AD-SP-60862-5
- Suppl:
- Alpha Diagnostic
Adrenal Secretogranin, bovine
- SKU:
- ECH-313-20
- Size:
- 5 mg
- Suppl:
- Echelon Biosciences
Adrenmedullin(1-52), Human [(YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2; MW: 6028.9)]
- SKU:
- AD-SP-55426-1
- Suppl:
- Alpha Diagnostic
Adrenomedullin (1- 52), porcine [(AA: see antigen, sequence too long) (MW: 5971.8)]
- SKU:
- AD-SP-100825-1
- Suppl:
- Alpha Diagnostic
Adrenomedullin (1-12), human (AA: Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg) (MW: 1513.7)
- SKU:
- AD-SP-100824-5
- Suppl:
- Alpha Diagnostic
Adrenomedullin (1-50), rat
- SKU:
- ECH-335-75
- Size:
- 0.5 mg, 1 mg
- Suppl:
- Echelon Biosciences
Adrenomedullin (1-52), human
- SKU:
- ECH-331-80
- Size:
- 0.5 mg, 1 mg
- Suppl:
- Echelon Biosciences
Adrenomedullin (11-50), rat
- SKU:
- ECH-335-80
- Size:
- 0.5 mg, 1 mg
- Suppl:
- Echelon Biosciences
Adrenomedullin (22-52), Human [H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; MW: 35766]
- SKU:
- AD-SP-55286-1
- Suppl:
- Alpha Diagnostic
Adrenomedullin (22-52), human
- SKU:
- ECH-331-82
- Size:
- 0.5 mg, 1 mg
- Suppl:
- Echelon Biosciences