Alpha Synuclein Pre-formed Fibrils: ATTO 594 (Type 1)
Product Sizes
100 ug
SPR-322-A594-100UG
2 x 100 ug
SPR-322-A594-2X100UG
5 x 100 ug
SPR-322-A594-5X100UG
About this Product
- SKU:
- SPR-322-A594
- Additional Names:
- Alpha synuclein PFFs, Alpha synuclein aggregates, Alpha synuclein PFF, Alpha synuclein protein aggregates, Alpha synuclein aggregates, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha synuclein protein seed, ATTO 594 conjugated alpha synuclein, ATTO labelled alpha synuclein fibrils
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Conjugate:
- ATTO 594
- Extra Details:
- Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAG
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/proteins/alpha-synuclein-protein-spr-322-A594/
![](https://www.stressmarq.com/wp-content/uploads/SPR-322-A594_Alpha-Synuclein-Protein-Protein-TEM-1.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-322-A594_Alpha-Synuclein-Protein-Protein-TEM-2.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-322-A594_Alpha-Synuclein-Protein-Protein-Thioflavin-T-assay-1.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-322-A594_Alpha-Synuclein-Protein-Protein-TEM-1.png?width=850)
![](https://www.stressmarq.com/wp-content/uploads/SPR-322-A594_Alpha-Synuclein-Protein-Protein-TEM-2.png?width=850)
![](https://www.stressmarq.com/wp-content/uploads/SPR-322-A594_Alpha-Synuclein-Protein-Protein-Thioflavin-T-assay-1.png?width=850)