Tau-352 (fetal 0N3R) Wild-Type Monomers
Product Sizes
100 ug
SPR-490-100UG
2 x 100 ug
SPR-490-2X100UG
5 x 100 ug
SPR-490-5X100UG
500 ug
SPR-490-500UG
2 x 500 ug
SPR-490-2X500UG
About this Product
- SKU:
- SPR-490
- Additional Names:
- Tau aggregate, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Aggregate, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, G Protein Beta1/Gamma2 Subunit-Interacting Factor 1, Isoform 2, tubulin-associated unit, 95-amino acid Tau protein fragment, Truncated Tau
- Application:
- Cell-based/Functional Assay, SDS-PAGE, Western Blot
- Extra Details:
- Alzheimer's Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing paired helical filaments (PHFs). Brain-specific tau isoforms vary in the number of N-terminal inserts and C- terminal repeat domains due to alternative splicing of exons; only the shortest isoform of tau, 0N3R, is expressed in the fetal brain during neurogenesis (2). Three-repeat (3R) isoforms have been shown to be more prone than four-repeat (4R) isoforms to form oligomers in vitro (3). The B Beta-sheet core of Tau 0N3R fibrilized using heparin differs from all other tau fibril structures known to date (4).
- Molecular Weight:
- 37 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/proteins/tau-monomers-spr-490/
![](https://www.stressmarq.com/wp-content/uploads/SPR-490_Tau-352-fetal-0N3R-Wild-Type-Monomers-Protein-SDS-Page-1.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-490_Tau-352-fetal-0N3R-Wild-Type-Monomers-Protein-Thioflavin-T-assay-1.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-490_Tau-352-fetal-0N3R-Wild-Type-Monomers-Protein-SDS-Page-1.png?width=850)
![](https://www.stressmarq.com/wp-content/uploads/SPR-490_Tau-352-fetal-0N3R-Wild-Type-Monomers-Protein-Thioflavin-T-assay-1.png?width=850)