Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.000
View basket & checkout
Proteins and Peptides

Amyloid Beta Pyroglutamate 3-42 Pre-formed Fibrils

Product Sizes
100 ug
SPR-492-100UG
2 x 100 ug
SPR-492-2X100UG
5 x 100 ug
SPR-492-5X100UG
About this Product
SKU:
SPR-492
Additional Names:
pyro abeta, pyro amyloid beta, Abeta, Amyloid beta peptide, Beta amyloid peptide, amyloid beta precursor protein peptide, pyroglutamate amyloid beta, AB BetaPE3, APP
Application:
Cell-based/Functional Assay, Western Blot
Extra Details:
Our Amyloid Beta pyroglutamate 3-42 (pyro AB Beta) Pre-formed Fibrils are generated from Amyloid Beta Peptide 3-42 pre-treated with 1,1,1,3,3,3-Hexafluoro-2-propanol (HFIP) using a previously published method (1,2). Our pyro AB Beta3-42 fibrils present as primarily long strands when observed under TEM and AFM, and have a unique high molecular weight signal on a Western Blot with an anti-amyloid beta antibody. Amyloid beta peptide (AB Beta) is generated by protease cleavage of amyloid precursor protein (APP), which aggregates into oligomers, protofibrils, fibrils and ultimately plaques. The accumulation of AB Beta plaques in the brain is considered a hallmark of Alzheimer's disease (AD), and most of the drugs tested for AD in the past 20 years have targeted amyloid beta accumulation (3). Pyroglutamate AB Beta 3-42 is an N-terminally truncated peptide species that is modified by glutaminyl cyclase and has been reported to compromise 15-45% of total amyloid beta deposits in brains of AD patients (4,5). Pyroglutamate AB Beta 3-42 exhibits higher aggregation propensity and neurotoxicity compared with full-length AB Beta 1-42 (6,7) and is an active target in the next generation AD therapeutic development (8).
Molecular Weight:
4.3 kDa
Purity:
>95%
Sequence:
pyroEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Synthetic