Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Alpha Synuclein S87N Mutant Monomers

Product Sizes
100 ug
SPR-499-100UG
2 x 100 ug
SPR-499-2X100UG
5 x 100 ug
SPR-499-5X100UG
500 ug
SPR-499-500UG
2 x 500 ug
SPR-499-2X500UG
About this Product
SKU:
SPR-499
Additional Names:
Alpha Synuclein S87N, Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein
Application:
Cell-based/Functional Assay, SDS-PAGE, Western Blot
Extra Details:
Human alpha synuclein S87N mutant (HuS87N) has Ser87 mutated to the equivalent mouse residue Asn87, effectively making it a human-mouse chimeric protein. Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse A Alpha-syn (MsWT) is faster than wild-type human A Alpha-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing pathology of endogenous mouse A Alpha-syn (1). A53T or S87N substitutions in human A Alpha-syn substantially accelerate fibrilization rates in vitro (2,3). Chimeric HuS87N fibrils show enhanced pathogenicity to wild-type mouse neurons, greater than HuWT, HuA53T, and MsWT fibrils (4). HuS87N fibrils can be used as a more human-like alternative to MsWT fibrils to induce equivalent or greater endogenous A Alpha-syn seeding and pathology in wild-type mice.
Molecular Weight:
14.46 kDa
Purity:
>95%
Purification:
Ion Exchange
Sequence:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
SDS-PAGE of human alpha synuclein S87N monomer under reducing conditions showing the protein purity. Lane 1: Biorad All Blue Standards (3uL), Lane 2: human alpha synuclein S87N monomer (2ug), lane 3: human alpha synuclein S87N monomer (4ug).
Fibril formation and seeding activity of human alpha synuclein S87N mutant measured by ThT in vitro. Human S87N mutant monomers self-aggregate faster than human wild-type monomers. Human S87N mutant pre-formed fibrils rapidly seed S87N mutant monomers and mouse wild-type monomers. Human S87N mutant fibrils also seed human wild-type monomers, although less aggressively than mouse wild-type monomers.