Alpha Synuclein S87N Mutant Pre-formed Fibrils
Product Sizes
100 ug
SPR-500-100UG
2 x 100 ug
SPR-500-2X100UG
5 x 100 ug
SPR-500-5X100UG
About this Product
- SKU:
- SPR-500
- Additional Names:
- MAPT, 2N4R, Tau40 neurofibrillary tangle protein, paired-helical filament, PHFs, SNCA, NACP, PARK1, asyn, alpha-synuclein, pre-formed fibril, PFFs, mixed fibrils
- Application:
- Cell-based/Functional Assay, Western Blot
- Extra Details:
- Human alpha synuclein S87N mutant (HuS87N) has Ser87 mutated to the equivalent mouse residue Asn87, effectively making it a human-mouse chimeric protein. Despite sequence differences at only seven residues, or 5% of the total 140 amino acids, the aggregation rate of wild-type mouse A Alpha-syn (MsWT) is faster than wild-type human A Alpha-syn (HuWT) in vitro. In wild-type mouse models, MsWT fibrils are more efficient than HuWT fibrils at inducing endogenous mouse A Alpha-syn pathology (1). A53T or S87N substitutions in human A Alpha-syn substantially accelerate fibrilization rates in vitro (2,3). Chimeric HuS87N fibrils show enhanced induction of A Alpha-syn pathology greater than both HuWT and MsWT fibrils in mice neuron cultures (4). Therefore, HuS87N is a good construct for inducing robust endogenous A Alpha-syn seeding and pathology in wild-type mice/cultures.
- Molecular Weight:
- 14.46 kDa
- Purity:
- >95%
- Purification:
- Ion Exchange
- Sequence:
- MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/proteins/human-recombinant-alpha-synuclein-s87n-mutant-pre-formed-fibrils-spr-500/
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-TEM-1.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-SDS-Page-1.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-Thioflavin-T-assay-1.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-Sedimentation-assay-1.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-TEM-2.png?width=200)
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-TEM-1.png?width=850)
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-SDS-Page-1.png?width=850)
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-Thioflavin-T-assay-1.png?width=850)
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-Sedimentation-assay-1.png?width=850)
![](https://www.stressmarq.com/wp-content/uploads/SPR-500_Human-Recombinant-Alpha-Synuclein-S87N-Mutant-Pre-formed-Fibrils-Protein-TEM-2.png?width=850)