Tau dGAE (297-391) Monomers
Product Sizes
100 ug
SPR-501-100UG
2 x 100 ug
SPR-501-2X100UG
5 x 100 ug
SPR-501-5X100UG
500 ug
SPR-501-500UG
2 x 500 ug
SPR-501-2X500UG
About this Product
- SKU:
- SPR-501
- Additional Names:
- Tau monomer, Tau protein monomer, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Monomer, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, Tau dGAE Protein, dGAE
- Application:
- Cell-based/Functional Assay, Western Blot
- CE/IVD:
- RUO
- Extra Details:
- Filamentous tau inclusions are a hallmark of many neurodegenerative diseases, including Alzheimer's disease (AD) and Chronic Traumatic Encephalopathy (CTE), collectively called tauopathies. Advances in Cryo-EM have revealed that tau filaments isolated from individuals with a particular neurodegenerative disease share a distinct tau fold - i.e. an AD-isolated Tau filaments' fold is distinct from a CTE-isolated Tau filaments' fold (1-3). Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models. Recent Cryo-EM studies have demonstrated that recombinantly generated Tau dGAE monomers will form the disease-isolated AD or CTE Tau filament folds under highly specific conditions in vitro (4, 5). StressMarq's SPR-501 Tau (297-391) dGAE monomers are purified following these exact published procedures and can be utilized to form these distinct folds using specific aggregation conditions.
- Immunogen:
- Tau dGAE (AA297-391)
- Molecular Weight:
- 10.165 kDa
- Purity:
- >95%
- Purification:
- Ion-exchange, ammonium sulfate precipitation and SEC purified
- Sequence:
- IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- StressMarq Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:https://www.stressmarq.com/products/proteins/tau-dgae-(297-391)-monomers-spr-501/