Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Tau dGAE (297-391) AD-mimic Pre-formed Fibrils

Product Sizes
100 ug
SPR-502-100UG
2 x 100 ug
SPR-502-2X100UG
5 x 100 ug
SPR-502-5X100UG
500 ug
SPR-502-500UG
2 x 500 ug
SPR-502-2X500UG
About this Product
SKU:
SPR-502
Additional Names:
Tau aggregate, Tau PFFs, Tau PFF, Tau protein aggregate, Tau protein, microtubule-associated protein Tau, MAPT, MAP, microtubule-associated protein, Truncated Tau Protein Aggregate, Paired Helical Filament-Tau, Phf-Tau, Neurofibrillary Tangle Protein, dGAE Tau Protein, Tau dGAE
Application:
Cell-based/Functional Assay, Western Blot
CE/IVD:
RUO
Extra Details:
Filamentous tau inclusions are a hallmark of many neurodegenerative diseases, including Alzheimer's disease (AD) and Chronic Traumatic Encephalopathy (CTE), collectively called tauopathies. Advances in Cryo-EM have revealed that tau filaments isolated from individuals with a particular neurodegenerative disease share a distinct tau fold - i.e. an AD-isolated Tau filaments' fold is distinct from a CTE-isolated Tau filaments' fold (1-3). Utilizing Tau filaments with the correct disease-specific fold is an important goal towards better mimicking specific human diseases in cellular and in vivo models. Recent Cryo-EM studies have demonstrated that recombinantly generated Tau dGAE monomers will form the disease-isolated AD or CTE Tau filament folds under highly specific conditions in vitro (4, 5). StressMarq's catalog# SPR-502 Tau dGAE (297-391) AD-mimic PFFs are purified and fibrilized under these exact published conditions that replicate the disease-isolated AD-fold (200 rpm at 37oC in 10 mM PB 10 mM DTT pH 7.4 200 mM MgCl2 for 48 hours).
Immunogen:
Tau dGAE (AA297-391)
Molecular Weight:
10.165 kDa
Purity:
>95%
Purification:
Ion Exchange
Sequence:
IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
TEM of Tau dGAE AD-mimic fibrils (SPR-502) generated from Tau dGAE monomers (SPR-501) by shaking 200 rpm at 37oC for 48 hours in 10 mM PB 10 mM DTT pH 7.4 with 200 mM MgCl2 added (Lovestam et al. 2022, eLife). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 200 nm.
SDS-PAGE of Tau dGAE AD-mimic fibrils (SPR-502) on a 12% Tris-Glycine Gel.
TEM of Tau dGAE AD-mimic fibrils (SPR-502). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 500 nm.
TEM of Tau dGAE AD-mimic fibrils (SPR-502). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 200 nm.