Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Alpha Synuclein S129A Mutant Pre-formed Fibrils

Product Sizes
100 ug
SPR-506-100UG
2 x 100 ug
SPR-506-2X100UG
5 x 100 ug
SPR-506-5X100UG
About this Product
SKU:
SPR-506
Additional Names:
Alpha synuclein protein, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, SYN protein, Parkinson's disease familial 1 Protein, Alpha Synuclein S129A
Application:
Cell-based/Functional Assay, Western Blot
Concentration:
2 mg/ml
Extra Details:
Elevated levels of phosphoserine 129 (pS129) on alpha-synuclein has long been considered a hallmark of Parkinson's disease and other synucleinopathies, where up to 90% of alpha-synuclein deposition in Lewy Bodies contains pS129, compared to ≤4% in normal brains (reviewed in [1]). Further, pS129 was recently shown to function as a physiological regulator of neuronal activity (2). Alpha-synuclein S129A monomers and fibrils cannot be phosphorylated at position 129, and therefore can be utilized to study phospho-S129-independent biology and pathology. Further, this material can be used to confirm induction of endogenous pS129 pathology in disease models.
Molecular Weight:
14.44 kDa
Purity:
>95%
Purification:
Ion Exchange
Sequence:
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPAEEGYQDYEPEA
Shipping Conditions:
Dry Ice
Storage Conditions:
-70[o]C
Supplier:
StressMarq Biosciences
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
TEM of human alpha synuclein S129A fibrils (SPR-506). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 200 nm.
SDS-PAGE of purified human alpha synuclein S129A fibrils (SPR-506) on a 12% Bis-Tris Gel. 2ug and 4ug of total protein were loaded into the respective lanes. Electrophoresis was run at 200V for 45 minutes with fixed voltage using 1X MES running buffer.
Seeding activity of human alpha synuclein S129A mutant measured by ThT in vitro. Human alpha synuclein S129A fibrils (SPR-506) will rapidly seed both wild-type and S129A alpha synuclein monomers (SPR-505) with comparable activity to wild-type fibrils.
Sedimentation assay of human alpha synuclein S129A fibrils (SPR-506) showing >90% of material is insoluble when spun at 20,000 xg. Lane 1: Biorad All Blue Standards (3uL), Lanes 2-4: human alpha synuclein S129A pre-formed fibrils (10ug) supernatant, wash and pellet.
TEM of human alpha synuclein S129A fibrils (SPR-506). Negative stain transmission electron microscopy images acquired at 80 Kv on carbon coated 400 mesh copper grids using phosphotungstic acid and uranyl acetate stain. Scale bar = 100 nm.